Scaffold Ga0209567_10000500

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209567_10000500

Scaffold Ga0209567_10000500

Overview

Basic Information
Taxon OID	3300025895 Open in IMG/M
Scaffold ID	Ga0209567_10000500 Open in IMG/M
Source Dataset Name	Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21392
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (82.61%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Helgoland, North Sea, Atlantic Ocean
Coordinates	Lat. (^o)	53.9944	Long. (^o)	6.8905	Alt. (m)		Depth (m)	29
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040633	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209567_100005001	F040633	AGGA	MPGIGVRRGKAAFLIGCESQPAILLQPEAIGAVMEV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.