NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207660_10213667

Scaffold Ga0207660_10213667


Overview

Basic Information
Taxon OID3300025917 Open in IMG/M
Scaffold IDGa0207660_10213667 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1511
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020982Metagenome / Metatranscriptome221N
F041239Metagenome / Metatranscriptome160N
F073806Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0207660_102136671F041239N/AMPAQGLGLSALWDERDYKACGASIECRGRFILGKLFDRDTPLLKTAWLAAFGTRVLGPPEIRTDEITKAQWGMILSHMGASPDEITDVQTRMGRT
Ga0207660_102136672F020982GGCGGMTRRHFMGSRIYKGLTYTLELEAIEESVFKAHARLSPSGPEVSVVDEASDSALKQAEAGIKQVIEQREAGAVVRERLPERMYGDVKYTIIVRTEATRVVAELYFIRSNAQPRRPGPGTFFALFEGKTKQGAVGQAERGLKAKLDKERTGTTAGRSSR
Ga0207660_102136673F073806N/AMTYTTEEFVRHSLRRTLRSVRYRNSFLCLPCLVTMTLGSLHPGWRPSEITRALDRIYAAPGVPMESRPAFRCAHCRSVKPCLGSPYL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.