NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207646_10004028

Scaffold Ga0207646_10004028


Overview

Basic Information
Taxon OID3300025922 Open in IMG/M
Scaffold IDGa0207646_10004028 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16237
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (86.96%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002143Metagenome / Metatranscriptome590Y
F008809Metagenome / Metatranscriptome327Y
F025584Metagenome / Metatranscriptome201Y
F035065Metagenome / Metatranscriptome173Y
F037102Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0207646_100040282F037102AGGAGGMNERTPDLTQQVLQPAMHQKLLLRAAELVAMGWTRGTAARDATGQKVRSTAPQATAWCVVGAVDRALYELLNVDVYDLLGLEVDAYDTAPCPLDMLRKLRRPLQCVLGRRDLAHWNDHVCPGPGAAEQLLREAAAAAARS
Ga0207646_1000402822F008809GGAGGMKRILGYLRDEQGIETLEWIAVGALIIAVALVVYPGTLQGGLITTVTAITNKLTGIVK
Ga0207646_100040283F035065GGAGGMTDREVEAISDFLRHFGSFGCRQICVRRAEPKPRTPEDVGRFVLEILAAWRAEGLDAERLYKVATTAIHFEAYMLPGPICMPACCRPWGALEPACPPGPGRPLTGAQLQQALLRAVPIGPPPAPDAPLPDDLDEDLKRTGLAP
Ga0207646_100040284F025584GAGGVGDPRLDEPRRWGVFWIHHEAEELRVHHRTTIPAGHARALVVTLLASGRVPPLQATLFDSESAHARPGLERFWGTTCRCDAVVYLILFINERCLVLALSGGALARACANGRNRRHHDRTNGGEQ
Ga0207646_100040286F002143N/AMAHTPDPNEAIQRFLGQWSPLTRAEALHLALQSLRDRVEPDRVLACELAWEVHAKGYWSQVRNADGTTYPTEEDYFRHVLGLASWRTAYKRLAIGRMLTRFEEPERSLLRSSLAAVGLAKASVVAPAIERVEEWRTWLQCASEMSTVLLQAKVSEALDALPRGREPAPPGERFRRAVLGAMPDIEAMELVERFFHLGKRVVGSPNPIAIFLAGCRECLPEWELQAARRPRGSAAASNSSVCPRGQTSV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.