NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207646_10117301

Scaffold Ga0207646_10117301


Overview

Basic Information
Taxon OID3300025922 Open in IMG/M
Scaffold IDGa0207646_10117301 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2391
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024987Metagenome / Metatranscriptome203Y
F030857Metagenome / Metatranscriptome184Y
F033242Metagenome178Y

Sequences

Protein IDFamilyRBSSequence
Ga0207646_101173011F033242N/AYDRFVSSMIEKTSVKKFVIIEKRQANKFPTAPVSVLLANVDELTGEEHDWNPANYGEEVQPYAIGRSSLKRFPVLAFESSEADIIAENLNSVIQNCQNDR
Ga0207646_101173013F024987AGGAGMRRAPVYNGINRVGLYSSKARGSFHPGPAVMRASNHLAVVCLFFGVALAAFLSGSLEQRIGNLFSFGFLPAISFYAGGHVLGQLLVFGVELCDLCFRYAVHLISGLLSWAGRRVSNLTEAPASSEASGIDN
Ga0207646_101173016F030857N/AKQVKRAQECRELQDKLVGDQPLTPERAEEITKTMDRTGCTARLPAH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.