NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207694_10042004

Scaffold Ga0207694_10042004


Overview

Basic Information
Taxon OID3300025924 Open in IMG/M
Scaffold IDGa0207694_10042004 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3525
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002416Metagenome561Y
F032806Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0207694_100420044F002416GGAGMNHLIHMINAPALSNSCAARIGRQLVSIGFGLKAAHGLVAVTLSIALGVVSVSAQTPSGQFFNGDSAQLGNSLRSVTFFLAAAMIIAGIIFIAVGIITSGLRESLSTWKFITGAACFAFGGVCAAIYAFSQGETVPVDNQF
Ga0207694_100420045F032806GGAGMRARPVRPNIYLPVVRFGVADSDWLSVLLISCICYLAPVPFGITLLYIPLQMWTWLLATAGAIAFFNYIRIGRKPYWLQHQVKALFSNHRQYRFIPNSRKSKLDRPWITDQQEDGRPPPKPSVTINSLLLQHNNSVQEACEENGTAIGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.