NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207650_10000026

Scaffold Ga0207650_10000026


Overview

Basic Information
Taxon OID3300025925 Open in IMG/M
Scaffold IDGa0207650_10000026 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)264152
Total Scaffold Genes240 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)163 (67.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001605Metagenome / Metatranscriptome664Y
F016574Metagenome / Metatranscriptome246Y
F087640Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0207650_10000026100F087640GGCGGMAKALEVWPLHVIEEALGDDADGVLPQAIRCAELRVRLPRHHIDMLEYRADQQETTVSGVLARELDGIASAHIEELSAALPGFAEAMAWPAG
Ga0207650_10000026216F001605GAGGMSVTQSEPQTLAQVPFKILDETLRQLRSTRNDIIRYGVWNTRNLTDDEFNHADDRKLLGYFRQDLLETRFLSKGRKIDLIQLWHWFDDQMTGTEPMLIGGEEFFVNVQDKDLDKVRKRISEIQSFLPTLRGDDLEAFKRVKYKLRRTVLRLTYDLHHLFKRLEKYRKNFGGPMAPRPDRIPLEAAVDIPEPPPIDEHEHDAE
Ga0207650_100000263F016574GAGGMLETDDIDRIRHIFLHPRPHVSISQVMALLGWTRREMSDAIEAGEVELWTTPIGKWFPRAEMMAKALEIWPLHVIEEALGAEGDGVLPQAIRTAELRVRLPRHHIDMLEYRADQQETTVSGALARELDGIASAHIEELSSALPGFAEAMAWPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.