NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207659_10209501

Scaffold Ga0207659_10209501


Overview

Basic Information
Taxon OID3300025926 Open in IMG/M
Scaffold IDGa0207659_10209501 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1561
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016064Metagenome / Metatranscriptome250Y
F016418Metagenome / Metatranscriptome247Y
F029574Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0207659_102095012F016064N/AMTQVESPRESVEYRGYSLQVSFASRQWQVLIGVVVKDRPTLPPEKQLVKGWNEEETLKRAKTRIDLLIESPSLH
Ga0207659_102095013F016418AGGMSYRGYDLEQKTLMVGWQITITKDGKFVNNGSVTKNLLSAVAEAEKFVDRAIAEADIASQSARL
Ga0207659_102095014F029574N/AMLKGIEKMERSARYIVRLQKDGQYMVVMSRPEWANREIPGFATEAEANAWIASRRKQSRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.