NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207664_10214915

Scaffold Ga0207664_10214915


Overview

Basic Information
Taxon OID3300025929 Open in IMG/M
Scaffold IDGa0207664_10214915 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1665
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040221Metagenome162N
F049810Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0207664_102149152F049810GGAGMNRTKWMRLSVRDLGDVIRWAGAQNAREIGEFRYRVVNGREIVSFRLVPRYAIDIGAREIIVVAYARMLGWRARLRDFRRIAGAWARRLQQTLGIAAAAPMAALPTHRLTRLATAMHPRVQPRQL
Ga0207664_102149153F040221GGCGGMAEPVLGIAGAVLLALAITALFLRPRRSRGRVVDIGLAVGAGLLGLAIGLVVAERVNGSAILAVATPEPAAPPQPAPEGSRYIETRLSLQFPIDDEYPTGSDGANVADWYAFRNSISYVPGAGEKTDKAQDQKLKLLADVSWSWLIVIAFDQPTRYSRINVSFTGGELPYYQIARQDPHYAVIHVQGRIPAGQMEITTSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.