NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207686_10000008

Scaffold Ga0207686_10000008


Overview

Basic Information
Taxon OID3300025934 Open in IMG/M
Scaffold IDGa0207686_10000008 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)245575
Total Scaffold Genes191 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)138 (72.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006673Metagenome / Metatranscriptome367Y
F091822Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0207686_10000008135F091822AGGAGGMDKSRLMSFEDAGKLLGGLHPNTLRQRKGGTERLTHVPGFGRRVMLIRDEVEALVDLKIGQAHAIERGRRKMLRLAS
Ga0207686_1000000821F006673N/AMFACLLIALVTVGHTQNPQTAGGVIRLKVRYKSGDLTRELPRKRFFLIKGSLQDNRSLIEAIRKTETMSRDCYYRGQGASRQLIKWLNENDCESVYCREVDDTYINGSEAVPEFKAAYGQALQELKTPEVARRWLANYVPAEMRDGYYNSKQKAIGVLIEQAETSTGKPVMSIMTDRKGTAYLTGIEPGTYTISNLLASETEKTSLLWICEREVKTTDLSIAMKRPFILSNETDPKVKCEIVERPLPICNK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.