NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207711_10000192

Scaffold Ga0207711_10000192


Overview

Basic Information
Taxon OID3300025941 Open in IMG/M
Scaffold IDGa0207711_10000192 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)65599
Total Scaffold Genes77 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)57 (74.03%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016854Metagenome / Metatranscriptome244Y
F031439Metagenome / Metatranscriptome182Y
F081191Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0207711_1000019224F081191AGGAMPEAIVAAIVELADDGYCRRGALSQRFPRIGERDLRRAVRRAVSQGLVLERRGPDGAWHVAVSSEGWNLHRSG
Ga0207711_1000019231F016854GGAGMAAPNTKTVPKRGEVWLSCPPYLMMARIVEVDTEAEPPVVSYELHDDDGSLLQAVEHATLDRGWWRTFQRLEPRFG
Ga0207711_1000019257F031439AGGMYLIPIALIILLALIAVAWSPIFALIIFVIGFVAFLAYAASKPRADEKLAPPEQPGSQPHNENDTPTGIWGERRPS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.