Scaffold Ga0207667_10037814

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0207667_10037814

Scaffold Ga0207667_10037814

Overview

Basic Information
Taxon OID	3300025949 Open in IMG/M
Scaffold ID	Ga0207667_10037814 Open in IMG/M
Source Dataset Name	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5159
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (44.44%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location Name	USA: Michigan, Kellogg Biological Station
Coordinates	Lat. (^o)	42.3948	Long. (^o)	-85.3738	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010474	Metagenome / Metatranscriptome	303	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207667_100378146	F010474	N/A	MKTSPIYTPSKLLVGDTELVRQHALTRWMSRDLTQAAGDFCRNLGLIPCYCECSPDHLTRYLFWRAPQGALMEVRSGRTKDKFEELDRTNHEKSWRLLSLHVNESEIYSAVWITPDHFETAKAFLLAHGITPAERRDS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.