NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208261_1001506

Scaffold Ga0208261_1001506


Overview

Basic Information
Taxon OID3300026076 Open in IMG/M
Scaffold IDGa0208261_1001506 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8332
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (33.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-0.4612Long. (o)-23.033259Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007891Metagenome / Metatranscriptome343Y
F018380Metagenome / Metatranscriptome235Y
F042559Metagenome / Metatranscriptome158Y
F084708Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0208261_100150610F007891N/AMTLYSNFTSNAIESVETKENAVFITYSSNLEKNYEYNCVNVPEFTNNLCSVLISNELQQDGGSVGRFIQQSRRDSVLTDK
Ga0208261_100150612F018380N/AMSNNTFTFTDDELLCLQVCLQNAPCPYDIGKKKLVSTLEDKIGKPPKIEVEPLSMPKYDLTKYGIND
Ga0208261_100150620F084708N/AMSYMNSMNQSKVDDELKKLAMDYIKATNANDQSLAETILNDMQVMRELMKEK
Ga0208261_10015066F042559AGGAGGMSVISEFYSGLLDKGYTEREIRESCKRHQERVAPDWFNGTYAEYLESMHDFLNGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.