NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208749_1030252

Scaffold Ga0208749_1030252


Overview

Basic Information
Taxon OID3300026077 Open in IMG/M
Scaffold IDGa0208749_1030252 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1143
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007756Metagenome / Metatranscriptome345Y
F009691Metagenome / Metatranscriptome314Y
F013094Metagenome / Metatranscriptome274Y

Sequences

Protein IDFamilyRBSSequence
Ga0208749_10302522F007756N/AMKQLNTLKRYYVNVKFEKYGTYTIEATSKEHALEIYNDGDYGWDDYTEDFGEFNEVVEDVEEELFADTQLTLSGVLS
Ga0208749_10302523F009691AGGAGMKTELNSKDYVTFARRFVKETVATMDIEELRSLVTDRIHEEIQEGENNFGQEGAFEEMMAWSEDVFLDVAKDFDLEFEGA
Ga0208749_10302524F013094GAGGMITAFFTGVIVAIPTSLVAMKLLNSSLFINNQELSHINEKISILIHQLDDYREERLAEKLGIEEGNIKLETTD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.