NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208390_1006428

Scaffold Ga0208390_1006428


Overview

Basic Information
Taxon OID3300026081 Open in IMG/M
Scaffold IDGa0208390_1006428 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3859
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036279Metagenome / Metatranscriptome170N
F057435Metagenome / Metatranscriptome136N
F062840Metagenome / Metatranscriptome130N
F078816Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0208390_10064281F062840N/ACCVIFYYMYNKFREGLIGNNAYLNWKAYIKKVVGAYAYRRVDNTMDDKANLKDMDKHRQLKGVLYVRLGMSILKQANG
Ga0208390_100642813F078816GAGGMEATANKKRSIYVLEGTYRNRKIENTSFDLVKCYQPYPHKEGGFVTVKIKDLEQYQAPKHTI
Ga0208390_10064283F057435AGGAGGMQKQIERQILLFTEATGVTKRAEVIHGTLFVKFNNPQDKWWFRRALKNFCKIFINRDTGINANDVGDEYAYDIVPQKDEKNWNRTEPLASQVDTMLELAGEMTEGK
Ga0208390_10064288F036279AGGMKGTKQILKTLFILFSFVSLQACSVPFANGVTGKDIIKVANAGKNIKNITKEGINEELITETKNILKDIKNGGKAQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.