NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207648_10048614

Scaffold Ga0207648_10048614


Overview

Basic Information
Taxon OID3300026089 Open in IMG/M
Scaffold IDGa0207648_10048614 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3713
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019547Metagenome229Y

Sequences

Protein IDFamilyRBSSequence
Ga0207648_100486143F019547AGGAMSMKAIRMTEKTLARAAMCLLTGAALMLPPATPASAEPGFHPTIIRGTGRPAELQLAYLASFPGGSLEPELDKLNFGAMVPGDPLIPDSDPTVTAGQGDVIVSIHRPLGLSPDDIPAESLFTPVNFGPGSLVRIKATFIAPVGPYATTGGFAIGLVGRIGGKDDLPLEPRVAATVNVRPNQLVRLNVPFGSVETRNTVLPQAVKDAIFSTTDPQPFTLELTIDRTTTPATGTAKLTVIDQVYTLSFTLADFLADGGPAITNVGPGIAVNSNGPGQTASVHVRDFRIYTNVGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.