NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207676_10587443

Scaffold Ga0207676_10587443


Overview

Basic Information
Taxon OID3300026095 Open in IMG/M
Scaffold IDGa0207676_10587443 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1068
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014046Metagenome / Metatranscriptome266Y
F068055Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0207676_105874431F014046N/ALLGPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG
Ga0207676_105874432F068055GGAGGVQAVVMVLRARSRQYWKSWLALSLLVAVAGGFVLTTASAGHRTAHAFPDFAARHGYDVIVYSEKKLPQLSTLPHVSSATPVPVTINATVGCASCRKPIDAINFLVNEVPPGQLPRMVTLLSGRMPRQSDPGEVLASFTLARDNGVRIGSVLRPQLITQAELETGKGKPSPALRPALRVVGIVAAESEFPSGGSSHYDLYATTAYAAAFNPRVALLRTYYVRLAHGAADLAGFDSRFRSPDVYGTADLDEAADAVQASIHPQVIGWYVLTGLAALAAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.