NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209509_1004713

Scaffold Ga0209509_1004713


Overview

Basic Information
Taxon OID3300026194 Open in IMG/M
Scaffold IDGa0209509_1004713 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7380
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (90.48%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035785Metagenome / Metatranscriptome171Y
F072820Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0209509_100471317F035785GGAGMIRIEAENALKMTEQEMLDVVFEASENSVIELNVVDPDSQAGDNDGVYLEVVKLDDYESVVRDRWPNQDGNRHIVSTSDIYAIYRALVDQVEEVA
Ga0209509_10047139F072820GGAGGMKPLHQVIDDAVTIRGIIDYLEKSVEPVSLHELAMTQHISNATALRLCRILEKASVIEHPTVTRIVMGAPQEVPQLAWRLTKSFWLGGCVYNAEDLARGAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.