Scaffold Ga0209871_1088173

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209871_1088173

Scaffold Ga0209871_1088173

Overview

Basic Information
Taxon OID	3300026217 Open in IMG/M
Scaffold ID	Ga0209871_1088173 Open in IMG/M
Source Dataset Name	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	602
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	68.6139	Long. (^o)	-149.3145	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030456	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209871_10881731	F030456	N/A	VAFTRRFRNAVEAEFLALRRSKAFLLRHLAAYSLLLMPGYGAIVAITAILGSISKKVLPTAAARMLLVPLAAAALFIFADNVLRAAAALIAKDEQVRVGMFLSFRVFWKLVKTLPVLAVTQIKSPLFFGPGWVIGDCLWPVICVVEGLSGREAIQRSRDLMTGLRSAGRALAIRHFTLAAFAIADAITSIGFLWRNESMK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.