NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208130_1003313

Scaffold Ga0208130_1003313


Overview

Basic Information
Taxon OID3300026258 Open in IMG/M
Scaffold IDGa0208130_1003313 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7089
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (68.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001504Metagenome / Metatranscriptome681Y
F028529Metagenome / Metatranscriptome191N
F082819Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0208130_100331310F028529GGGGGMRLSKFLTENLDTKTVNLTLTFDERSELLRFFEMYDENIDQLHPLVESVQDKLLGID
Ga0208130_10033134F001504N/AMTYDTEHYYAVQSFLEDDELHKIWNIIEIAMNREGYDVENAELSMRLYDSELTENVECDMEHLL
Ga0208130_10033139F082819AGGMSYTKNEIALETFISNVNSFFYYVGEDDDLIPFPRYEIRERLDKYVSQFMKSIEVEGDND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.