NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209017_10019870

Scaffold Ga0209017_10019870


Overview

Basic Information
Taxon OID3300026280 Open in IMG/M
Scaffold IDGa0209017_10019870 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1982
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002970Metagenome / Metatranscriptome517N
F005302Metagenome / Metatranscriptome405Y

Sequences

Protein IDFamilyRBSSequence
Ga0209017_100198702F005302AGGAGGMSHTGVIDGLFAGNFAVEISTNGTAWTAVSNATVKIDDIELSRPSGEAYVGGSSDYATVTIGKREPVEITLTFLYSEATNSAANTVFDAFQSANPRLGVRWSPRGLVGSARAYATSNDGATFGLGGITGVTHHALDPSDPEPFVAMVTVRAPAIRQYTLPANPTNLNPPA
Ga0209017_100198703F002970GGAGMSSSTVINIIEMLANLAVQYNNATVSVRRLTTQTNWVDAAQLPVRIIPALGGLRLIEGGVYTATRATRAVWEIDDLLLVRDVGMGRGVADTASALVRYIEDYVARLRFAWLARGDVQLINVSGIIDVVRYGERAYEGVTMTVRFAHLVRAPSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.