NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209510_1129826

Scaffold Ga0209510_1129826


Overview

Basic Information
Taxon OID3300026290 Open in IMG/M
Scaffold IDGa0209510_1129826 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)863
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069750Metagenome / Metatranscriptome123N
F078674Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209510_11298261F069750N/AFVEGEKFLIKERKNQKGKKTQYYLIRLQPFQYVSSLFPTGEEESFTFDYEQKIYRLEKKEHSVCLKYV
Ga0209510_11298262F078674AGGAGGMEALKKAVENRKAPFEIEGKAGDRIISLRVSEKMGELLEEQAQEWDKSISDTLRGIINFYFLPPLLLEAWEKKVQALIELDIKTVGENRADLNAPTQAQRIEHVLVDGEEAEEYAHFINELWNKNVKYWEILREEALSMSNTAVKRLKEELEALENALTWEDIAKRFEEKEQP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.