NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209839_10049255

Scaffold Ga0209839_10049255


Overview

Basic Information
Taxon OID3300026294 Open in IMG/M
Scaffold IDGa0209839_10049255 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1531
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)68.6135Long. (o)-149.3144Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003832Metagenome / Metatranscriptome466Y
F005268Metagenome / Metatranscriptome406Y
F025325Metagenome / Metatranscriptome202Y
F045285Metagenome / Metatranscriptome153Y
F058360Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0209839_100492551F058360N/AVPQVEAAMTASTFSMALAGSGAMPDPDASFMLKVEQAVDRVLSRSDWPRPSTKGNRIVGRKPNPEEGN
Ga0209839_100492552F003832GAGMQSIAEKLRSEAKWPPEEGEVLSFTTSVGSETATLKEVRWGLVWRDFILEDGRVIPEHRIAGCPQPQVWRKMDEVTDDEREDCEERLLSMAGSGMDPRQRDQSFWAELNQYLAYTYLRYKQASGRVQDKVQETER
Ga0209839_100492553F005268GAGGVTRSEETEDQQAWRVLSEAGLVEIRLDEFAERIADVKRIVIVRLRELLDFDNGIEERESAAYSLGTLKGLELKVLANVPPRSDPSEV
Ga0209839_100492554F025325AGGMFRRGLTRRRSDLSMLSDGQQRRKKTWEELVAAASMESDPEKLAMTMEEIFAALEERGRTASLSQDPSGFREHPTET
Ga0209839_100492555F045285N/AIPKMSFGLAVAVLLTSSALSQSNTSRIGDDYARAALRAIIYTNQSGITAERISILVDEADVEASTPAEEASLKEINRILGVWISRPISDHQACYLALKMNLKARNGATPEACK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.