NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209235_1119879

Scaffold Ga0209235_1119879


Overview

Basic Information
Taxon OID3300026296 Open in IMG/M
Scaffold IDGa0209235_1119879 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1105
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001681Metagenome / Metatranscriptome652Y
F001901Metagenome / Metatranscriptome620Y
F049517Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0209235_11198791F049517N/AKDPSSGTSTWHQRHVLSDVTLAQPLQVIAFSGAKPPAWAKPHADRPSHDCFTFQVLADGHVRLALVGVREADDAVIVVTKQAATAPRLFRRYAPNVLLWTVPSDKA
Ga0209235_11198792F001681GGCGGLSGVWSMKTLRLQRDPDGFFLWHPDYAPWIVGRHSLAANPNDRAFFDPNTSEIAWSSRDGMKDYEIDELAARHLAGELVEMPQFESEREVEAWFLERGFKVEWI
Ga0209235_11198793F001901N/AMTRRKQPWGQQRGWIVPADGSPPQELPQQMVGQKLISWPGTMPEKEPAKHIASKDYYHRHVLNPEGVSVYVPEGRDAESLPESIKNEIRRQLKGQS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.