NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209236_1045099

Scaffold Ga0209236_1045099


Overview

Basic Information
Taxon OID3300026298 Open in IMG/M
Scaffold IDGa0209236_1045099 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2239
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019109Metagenome / Metatranscriptome231N
F026521Metagenome / Metatranscriptome197N

Sequences

Protein IDFamilyRBSSequence
Ga0209236_10450991F019109AGGAMRGSVLGLPLWLILAVCVVPPIAYSLSRAAAVPVELILPTAVAMEVVFLTQTVQQALRRAEVRRHFGFALWELHQELSQHLESLDRRLTLVRQGVNSEPNLDSLRTWGSSVDAFPVDAWDRFLAIGGLHRLLDSAPDQVASNLYRYYHGV
Ga0209236_10450992F026521GGAMDDQEAEEVGVDQVFDARMKRAVAVLQALLDYYRVKKVPPIATVKRIEIEDAALAMVTGEFCLTDVALRLDTLRYDFNAEGELLTDEDGFPPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.