NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209468_1004411

Scaffold Ga0209468_1004411


Overview

Basic Information
Taxon OID3300026306 Open in IMG/M
Scaffold IDGa0209468_1004411 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5569
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001175Metagenome / Metatranscriptome756Y
F001699Metagenome / Metatranscriptome649Y
F018903Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0209468_10044113F001699GAGMKLQLRHFFVALLPLLFGLAASWGFAFSQNTCGRLVGPIFAPKCHWIQLQYQLGFQMAGTLLGCLIAAALGASLERRSRRAAERAKLDQGVSA
Ga0209468_10044117F001175GAGMRAVMVGALGLVAACGPSNPCSGHQFDRLRRYSLPYAGHWSVARGDSLTFPAAPGMSDRFRLQDITLDSATVVVGRDCVFRGQMVFRQPRAETLAVSWFGQPEQAIVSGWPADLGPFAGVSLAWAGRDSLSGAILLDSKLGVQAKPGMTARFVAGRVGRARLSSSP
Ga0209468_10044118F018903N/AMKPIFWAVPICALLACGGSGQSGQTVNRDTLTERQKDSILANSKIPNARAVGSAMRAADSTSAGIQRADSVARDTTEY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.