NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209153_1053053

Scaffold Ga0209153_1053053


Overview

Basic Information
Taxon OID3300026312 Open in IMG/M
Scaffold IDGa0209153_1053053 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1441
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046667Metagenome151Y
F051414Metagenome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0209153_10530531F046667GGGGGMSESLYSSGTNMATMIIYLRAHKRVSSRVITFSLVAFCAFWLTPSWREVGPFGFLFFFALFMMLIVSQIFWVGRVVDLGERFIPGKPRRAWLTAIASVVCLFFFAYNIGLYISPWKIPRADSTHLSLRHVLFEAPFWWWFVGSWAGFALVLVFWALDRVGRAAAWACRKARNAAAGHAATPMPGGIALDPPSPARRR
Ga0209153_10530532F051414AGAAGGMEYYPSFFPETALALLQALLYSMACIMAGAALIALSVYIALVCSEMFFSQSRSKTQRAKAPQSARRVLVAKEGLELPAVETRILVAPNREEVVRVTTPVHGGQIPMTAPATLESEPTWS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.