NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209131_1001538

Scaffold Ga0209131_1001538


Overview

Basic Information
Taxon OID3300026320 Open in IMG/M
Scaffold IDGa0209131_1001538 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15990
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (56.52%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000188Metagenome / Metatranscriptome1692Y
F002853Metagenome / Metatranscriptome526Y
F004677Metagenome / Metatranscriptome428Y

Sequences

Protein IDFamilyRBSSequence
Ga0209131_100153815F002853GGAGGMSRAQTQTRQLTDQERANIDALNQQFFGQQQQIGSTLLPLYQSILNNPGLSPADKAAVTGQSQGALSSAFDALQQSAQNRLARTRNSAGFGELTGELARQKGIAEAGQAQKNQLAFTNTAFQRQMAALQGLSGLFGVDSNLLGRTLGIPAELLNVRANASRSNGGGFFSALGSGLGSTLGALPGAFF
Ga0209131_10015385F004677AGGAGGVNHYKTQPPWEFLLSASRNSLQSYELSRLSHAANLRKEIGALLDLWMEENSAAMLARWLMEQRERPPQALEDVPAGESLPKNGHAVSDNFFADRAVTPPANRGPA
Ga0209131_10015388F000188AGCAGMSVKPKLAFDVCWEVYRGAREVLETKRGISALNWKDTGKFLWRPDFRPRLNEWVADFALVGRAALEGPDWASRMVLFRLYYLGLAPYENARHFLGLSETNWVNWTEQIRHRCGKRTYKPRHVPTTEIFYLL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.