NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209470_1040190

Scaffold Ga0209470_1040190


Overview

Basic Information
Taxon OID3300026324 Open in IMG/M
Scaffold IDGa0209470_1040190 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2320
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002367Metagenome / Metatranscriptome566Y

Sequences

Protein IDFamilyRBSSequence
Ga0209470_10401903F002367GGAVQDVALKDPVELVVKDTVPVGVTPPAPEESVTVTVHEDGVLSSTLAGEHETLVVVALLVEARLKLPLLPV
Ga0209470_10401904F002367GAGGVHDVALNEPVLLVVKLTLPVGVTAPAPEESATVTVHVDGVLSRTLAGEQVTVAVVALIVDARVNDPLLPVWTLSPA
Ga0209470_10401906F002367N/AVYVTLQVPEARVQLVALKVPVLLDVNDTEPVGVTAPAPDASATVTVHVEGVLSNTLAGEQLTVVLDARIVEASVNGPLLPVCMLSPA
Ga0209470_10401908F002367N/AVYVTLHVPEARVQLVALNVPVLLLVKLTVPVGVVPPAPEASVTVTAHVLGVLSRTLAGEHDTLVALARRVEARLNVPLLPVWTLSPAYVPVI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.