NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209801_1000583

Scaffold Ga0209801_1000583


Overview

Basic Information
Taxon OID3300026326 Open in IMG/M
Scaffold IDGa0209801_1000583 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23804
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002291Metagenome / Metatranscriptome574Y
F030042Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0209801_100058311F002291GGAGGMSSKPLRQGSLVMLWAGENPAVHANLLEELQAAGIPFADKSLGDDEVAPTADPLPIDWKPRFGFEVTVLSTDLAAAREVLEKLLDEEPADVEIPARDEVAAAEPPLLVATETHPAVEIWNGKDDRMAQFLTSAMQENEIPIHLENPGEQTRIFVSAANEKRAREIVREIVEGAPPE
Ga0209801_10005838F030042GAGGMTDYPQRVSDSFYERKRLIRLRRKKENLRFWEEFRIIPRWLTALVAVLYVIALVIAITVNLAQAHNPNGNNMFPWELRDNPALASLAMAGIVTAVSLMMAVMIFMVAYVNRDASRRGALLCGQF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.