NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209801_1195631

Scaffold Ga0209801_1195631


Overview

Basic Information
Taxon OID3300026326 Open in IMG/M
Scaffold IDGa0209801_1195631 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)815
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000805Metagenome / Metatranscriptome883Y
F012223Metagenome / Metatranscriptome282Y
F019193Metagenome / Metatranscriptome231Y

Sequences

Protein IDFamilyRBSSequence
Ga0209801_11956311F019193N/AITWAPTKDLLDWVKTRQKIAANASFAKKQPTDPFMQEAMRMFPGLSPSDRFKVNDRKTPLSLQDAAAGIKTIYEDMLNRAWADAQARGEKLPPVSQRDIPPTVPGQQ
Ga0209801_11956312F012223N/AVRFCGLPSRFLAAWKAGHFQELDQMGSIPLLVEEEDYYTPEWAFDEEEWTE
Ga0209801_11956313F000805AGGAGGMILGVLPHSMPNGDSPQHARDYYTYLQGHQETLHVPKTWEVDWLSLAWLWGFAIVLGLAIVFWVWQNRTTRQRTGIYPVDSFGGYTTELAGPATFFFVLLT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.