NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209377_1002347

Scaffold Ga0209377_1002347


Overview

Basic Information
Taxon OID3300026334 Open in IMG/M
Scaffold IDGa0209377_1002347 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12345
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (77.27%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001681Metagenome / Metatranscriptome652Y
F009972Metagenome / Metatranscriptome310N

Sequences

Protein IDFamilyRBSSequence
Ga0209377_100234720F009972GGAMPTNASLEKQPSQSGRDPRTPEPKPGPPRGVYEASFSAAMPESSQRFRLVIARASDSTPGDVSGIVTRLHTDTELFWLLRIARPVAAAPKVCRRSVATCLALLMLDDHLRVLRVLPMASVPHTPGTGVLRSDGVIQTYLGGVLRPRALADTKRIAELLINGHSSYLDTLCRALSGDETPEGFEAVPADHELYDPEAEQYFAPPLTAWYRAGVLVHPFVPSTGTT
Ga0209377_100234721F001681GAGMRNQESQGPVEAQRVAWGRLSGAGSMKTLSLQRDPDGFFLWHPDYAPWIVGRHSLGANPNDRAFFDPNTGEIVWSSRDGMKDYEMEELAARHLVGELVEMPQFESEREVEDWFLERGFQVEWI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.