NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257166_1021584

Scaffold Ga0257166_1021584


Overview

Basic Information
Taxon OID3300026358 Open in IMG/M
Scaffold IDGa0257166_1021584 Open in IMG/M
Source Dataset NameSoil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)853
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)44.23Long. (o)-122.22Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012292Metagenome / Metatranscriptome282Y
F063996Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0257166_10215841F063996N/AVKKQYFFPCLFVRAAKGLALLVILIGIGFCLLRYYQASIAAGAVAYQSSANLQRALDRLKDAFLSTEQIVNSFNAGNQSTTPSVQGPRFPVKIDSSDDLARIAAELSRVDHERQQLKESIVSRFETLVKGI
Ga0257166_10215842F012292N/ALVQQLPLPVSESVSSLVDRARDFRAKLGYETALSECRTETATVDALSAIDQITRNIAGKDASAANSRLTDFLKSNPEPMVDNQKPLWRYLTSIRLLCNRLEKEAEIHLQRAQASVSAGRIGEAIREYQEAYRAFPNPATAEKTRQLQSNSLGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.