NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257176_1000432

Scaffold Ga0257176_1000432


Overview

Basic Information
Taxon OID3300026361 Open in IMG/M
Scaffold IDGa0257176_1000432 Open in IMG/M
Source Dataset NameSoil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2738
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)44.23Long. (o)-122.22Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002770Metagenome / Metatranscriptome531Y
F003044Metagenome511Y
F047802Metagenome / Metatranscriptome149N

Sequences

Protein IDFamilyRBSSequence
Ga0257176_10004321F003044GGAGGVRFAAIVHCSKCKQPIVSGQGFGYVCFKIPGEEGYHFFHRRFRTGDCWDDFLRE
Ga0257176_10004322F002770AGGAMNTLRSLLFRTLVPVSFATICVYITYAKEGPALVPIARNLAWNDFITQIKFLPLDSPQDSIDKEMLVIQRFLKEHETETNVGVYDLAVFRAIDQVRARLHKADKDLETLRNELSYKEEQARLGR
Ga0257176_10004324F047802N/AINPGTTPWSTVGGRARVNLATGHVSFDVDGLVLNGGNATGTPGPVDQVEGSLICDAGQKDQTIFTTTPVPLNAQGNADFSGTFNTIPGTCTNPLFLIRIGPDLPGANQRWIATGAVRSFGDSNGHN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.