Scaffold Ga0247604_1057546

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247604_1057546

Scaffold Ga0247604_1057546

Overview

Basic Information
Taxon OID	3300026460 Open in IMG/M
Scaffold ID	Ga0247604_1057546 Open in IMG/M
Source Dataset Name	Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	929
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	36.8313	Long. (^o)	-121.9047	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033439	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247604_10575462	F033439	N/A	KKLPYSKNVEKHILNCIQGGVGIRDMIASMQHLQDAPKSLSTMYSTYGDTIHAERARINGQVGKKVIDQALEGDFKSQEFFLRSR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.