Scaffold Ga0257154_1039447

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257154_1039447

Scaffold Ga0257154_1039447

Overview

Basic Information
Taxon OID	3300026467 Open in IMG/M
Scaffold ID	Ga0257154_1039447 Open in IMG/M
Source Dataset Name	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	721
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location
Location Name	USA: Oregon
Coordinates	Lat. (^o)	44.23	Long. (^o)	-122.22	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034638	Metagenome / Metatranscriptome	174	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257154_10394471	F034638	GGAGG	MTHLRRAIVLLFFSCCIAPLAMGQVTFKVKIQSTPMERQLLFAKLNERAATHHIQFVLVESGFDYRVAYGVAGPVMTPYGPAAPSASVTKVFDPAGAELFTFARDGRWTPDAAANATAKEIIKRIRKLRGLG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.