NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256805_1047131

Scaffold Ga0256805_1047131


Overview

Basic Information
Taxon OID3300026485 Open in IMG/M
Scaffold IDGa0256805_1047131 Open in IMG/M
Source Dataset NameSediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)562
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.3377Long. (o)-81.4644Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067249Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0256805_10471311F067249N/AGAGVKTLLNGTQQNPNKTLRLKFNELQATTNFKNFAVVVLSETLLPPKGPYKWRFKEDMIGKANCKVFTLVARQLYPPGGLYIKVNIAEMLAKEQLRKTDEFQKLINYLKCL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.