NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257165_1003681

Scaffold Ga0257165_1003681


Overview

Basic Information
Taxon OID3300026507 Open in IMG/M
Scaffold IDGa0257165_1003681 Open in IMG/M
Source Dataset NameSoil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2096
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga oryziterrae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)44.23Long. (o)-122.22Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000180Metagenome / Metatranscriptome1730Y
F013147Metagenome274N

Sequences

Protein IDFamilyRBSSequence
Ga0257165_10036811F013147N/AYGGACRFELDVAGGSLVISKEFERSNLAMELKAGKKRLELVLHGLTNEQCWMAGAVRSDSISMVVSRLISNEFLALEEVREEPSRSEGKQSTGVQPRTRFVERTLRADSNGSIESLLAEFDVVRSAIIRLVKKGVGNQGQYSTLTEACVTRFNEHIEQIERWRASQLVGFSPTRLRAEALESELNAAILEIGEEDFLLDNFDLKSLFSESLSRYYSDEVVLWLGAELTNGKHAFFQRLADVLEPVHTFLEMGMACVGLFRVLSSSQDSQGDLISEWEAVLGGPYSTGAAIRWRTVRVWKQRVVIAERIEALAWVDQQGI
Ga0257165_10036812F000180AGGAGMINKLSFVTANELYRDSYASSQSQERALNAAIVQAEIGEGYEQFLEIFDAFYADDVEVSSESQEEPIRGKAAARSLLTSFLFPLHVMAEVGGLLVSIRHTAIPADATVETHSAWTVDLVGASGTTCTLSWRVFRKWHGSRVVYEHHYDEQQIGGPLTLNVLSFNAIKPALGTHQPS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.