 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300026519 Open in IMG/M |
| Scaffold ID | Ga0256839_1114428 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 354-166 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 901 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: Mid Atlantic Ridge | |||||||
| Coordinates | Lat. (o) | 36.2297 | Long. (o) | -33.9011 | Alt. (m) | Depth (m) | 2262 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071990 | Metagenome / Metatranscriptome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256839_11144282 | F071990 | GGAGG | MAVPTTRFRVIPNSTATTAVDTPAKRLGIISGESLVSTGAGNEADLGTVNISAGAANSAVIHMLWDVTADGGNTLVDTFKLWLSANGFDVAASVLRFAAISGADQTIPTNTQNYVANATTASYTFADMPETEPASQNVYPSDEGTSMALATTSDDAIMWAV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |