Basic Information | |
---|---|
Taxon OID | 3300026519 Open in IMG/M |
Scaffold ID | Ga0256839_1114428 Open in IMG/M |
Source Dataset Name | Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 354-166 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 901 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: Mid Atlantic Ridge | |||||||
Coordinates | Lat. (o) | 36.2297 | Long. (o) | -33.9011 | Alt. (m) | Depth (m) | 2262 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071990 | Metagenome / Metatranscriptome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256839_11144282 | F071990 | GGAGG | MAVPTTRFRVIPNSTATTAVDTPAKRLGIISGESLVSTGAGNEADLGTVNISAGAANSAVIHMLWDVTADGGNTLVDTFKLWLSANGFDVAASVLRFAAISGADQTIPTNTQNYVANATTASYTFADMPETEPASQNVYPSDEGTSMALATTSDDAIMWAV |
⦗Top⦘ |