NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209690_1015216

Scaffold Ga0209690_1015216


Overview

Basic Information
Taxon OID3300026524 Open in IMG/M
Scaffold IDGa0209690_1015216 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3994
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028468Metagenome191Y
F053938Metagenome / Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0209690_10152163F053938N/AMSKIQEKESTLLNNLSGTEIANELDSRLRDLEKNIAVAREFIKLADESYSELRHKWNLLHEEVRNKSETSRTGPAIVADEKRTTRPRNKKPSKTRETEVTELNKAGSLSSTDISEKPEGHARRIKTTNRPKKEPEISGKDADSIPSEKPSQPYRDPGRRRGRTSGRN
Ga0209690_10152164F028468GGAGGVQRQSRVMTQSMFTDEPETNGEEFDLKKLFVRILEKDDWTDRLASGYGKIRGKIRRPRRDTKLSKELLLLVPDMKEVEKAYIEMTSGYKDFIRDVVKASRLRQEIQKDTPSKKDPSRGDF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.