NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256869_1000283

Scaffold Ga0256869_1000283


Overview

Basic Information
Taxon OID3300026526 Open in IMG/M
Scaffold IDGa0256869_1000283 Open in IMG/M
Source Dataset NameMetatranscriptome of bovine rumen microbial communities from Lethbridge, Alberta, Canada - Rumen RJG_05 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19285
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (17.95%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009724Metagenome / Metatranscriptome314Y
F046128Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0256869_100028322F046128N/AMKKYLVRFTTKGGDYDKEWCYANSEEEAAEIILDEHWDIESIDMVNEL
Ga0256869_100028338F009724N/AMETNVIFSKFETIGTTKDEAIRNAAPLNLRVDATQAYKKWAKENVTNEDNVKEWMKDYLKKKKFTMPNDGAYIVLQSAVTDTRERPYKVTKPEYKTRTHSPERFYILRDATGHEVGREKTSKAAEQAAKDFVIDYKEDITINVEWDSKEKNSLYATVKYTPSKGTQKAKLLVFGYKSID
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.