NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256869_1246845

Scaffold Ga0256869_1246845


Overview

Basic Information
Taxon OID3300026526 Open in IMG/M
Scaffold IDGa0256869_1246845 Open in IMG/M
Source Dataset NameMetatranscriptome of bovine rumen microbial communities from Lethbridge, Alberta, Canada - Rumen RJG_05 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)718
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097172Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0256869_12468451F097172N/ADVVTAEAATKKVTSAYRYHIDGYDKKGYPASYSKASFYKDLNSLPAVKTGKTTINVPAVTSSVKSVSKEKDNPEYESFVKFKAPKTGKYVFTLNNLQGTDDKSLKCFSGGIYKPVKNGKKYTLEDLYPDEVGDYTTLYENNYLARLRTILDNYKAEHPEYADVIEETYSDETDFVNHRPVNKIKFTTRLKKGQIYVFVIDNRGMAKAVPPYFTTHGSDEQSCLWGGNYLKAYSFDMNIE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.