NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209058_1122037

Scaffold Ga0209058_1122037


Overview

Basic Information
Taxon OID3300026536 Open in IMG/M
Scaffold IDGa0209058_1122037 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1282
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005908Metagenome / Metatranscriptome386Y
F049536Metagenome / Metatranscriptome146Y
F057269Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0209058_11220371F049536N/AAENVLLADEGVLVADTGIASALGKPATPRNDMAAVQSLAREMLTGSKPTIGEEPLEHTRTLPLWLTEWLRSRWTDAGRALAGMRPPPPSSSQSSQLFA
Ga0209058_11220372F005908GGAMLKPVMQLAAVGLVGIVAWKLGAAFLLPLFFFVFKIGLIVALIMLAFWFFNKKSRGKEDTPPASS
Ga0209058_11220374F057269N/AGVMWRRSSSSTEEVGGLSFIGGTPSFSARDPNDAYGRLINQLVYNVTYDVRSTWVDQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.