NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256404_1005405

Scaffold Ga0256404_1005405


Overview

Basic Information
Taxon OID3300026549 Open in IMG/M
Scaffold IDGa0256404_1005405 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_01
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22632
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023770Metagenome / Metatranscriptome208Y
F096242Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0256404_10054056F096242N/AMLLKLIKIREMNSGAHCEVWEANLLMGDHFLARVFVLNEHLPLELIYRLTVSWRGICIQGRHCGWQWDNEVAERMITHYLEQIQASHEEIRIEVCRPKPDLPGYPEVDYHPDDYPIVLIDDLEEDEIPEEPYEEPEYEI
Ga0256404_10054059F023770N/AMAVVEFDPGIDSVRGILMGTDPFYIRRYPGREGVMHIVQARPNRSDHIPSAAEAHTRIVFAQKYGHEKHLAFLERKFKDQLTINFNENG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.