NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10000003

Scaffold Ga0209648_10000003


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10000003 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)125941
Total Scaffold Genes102 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)83 (81.37%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000783Metagenome / Metatranscriptome893Y
F000923Metagenome / Metatranscriptome833Y
F025474Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_1000000349F000923GGAMKTKDKSRKWMWMFLATLVSLQMYFVWELLAVFALFALGFAAVASVVGSLYMLHRFWALTVDRIADSRHPVMVAARQGVYAIEDVARRPFRRPGSAAAR
Ga0209648_1000000351F025474AGGAGVATTGAARAKETVLPRSATITIRDQKPHPYGKVEVAPWTGRVHLANKDKKDYRLRFWKPDTDPFSGIDILIPAGGRITLLIKRGDHFMYGVLDVDDKVATGKGPGPIVN
Ga0209648_1000000378F000783GGAGGMVAAAGVWKKKRDDLKTKRNSLFAIYTKDPQNFSLAREIKALDDEIADCTQHVEQERRAEQRASSPAAKLVTTPK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.