NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10407780

Scaffold Ga0209648_10407780


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10407780 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)885
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015459Metagenome / Metatranscriptome254Y
F028010Metagenome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_104077801F028010GAGGMIYLTWLVILLIPYWLGPIIVWLTQKAGARPVFEPFAPGRHVVPEDVAASFRQTCDALATEGFRVAADLFQTGQMRHVSTRVALLDHAETTELALAVATFTAARPARLVASYAELPTKFRDGRTVSVHNSPLLGSFTPPPSRVVVRLPIVRDPARLCRVKRAYLDRHYRGLERVPFEHQDDPARFLADAMVRELTEQVEA
Ga0209648_104077802F015459N/AFPSKGAFLLALFEQYAAVARSGAAARQASWFIPLTLQFAAHAMRDPLLRRRFAVVLAEAPDGGTPDGQLLKALGRVLPPALPSPPRAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.