Scaffold Ga0208840_100634

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208840_100634

Scaffold Ga0208840_100634

Overview

Basic Information
Taxon OID	3300026695 Open in IMG/M
Scaffold ID	Ga0208840_100634 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN391 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	713
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location Name	Willamette National Forest, Oregon, USA
Coordinates	Lat. (^o)	44.20517707	Long. (^o)	-122.1284473	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002784	Metagenome / Metatranscriptome	530	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208840_1006341	F002784	AGG	MNEFTDKNEQAFLDACGAIGVEPNATVNKQKERYLVSEFLKHPVSWLETEILYHSYTTRGEAQEVANGIDRMISECAPVGRSKLFPRPKHSSAL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.