NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207846_102728

Scaffold Ga0207846_102728


Overview

Basic Information
Taxon OID3300026710 Open in IMG/M
Scaffold IDGa0207846_102728 Open in IMG/M
Source Dataset NameMarine sediment microbial community from La Parguera, Puerto Rico - PR Tt Sediment 3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1177
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location NameBioluminescent Bay, La Paraguera, Puerto Rico
CoordinatesLat. (o)17.96725Long. (o)-67.0188733Alt. (m)Depth (m).4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042645Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0207846_1027282F042645GGAGMPRLSDLDIYEIRQFFEEALNQARCTNKRDKMRMRRKIRDEVFNLLTWEKPTPTSIMNRWEERLHDIFSVMPYGFKDDLFHILSDKMLSPLQQEQS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.