Scaffold Ga0208475_1031150

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208475_1031150

Scaffold Ga0208475_1031150

Overview

Basic Information
Taxon OID	3300027018 Open in IMG/M
Scaffold ID	Ga0208475_1031150 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	526
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis → Caldicellulosiruptor → Caldicellulosiruptor kronotskyensis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location Name	Manhattan, Kansas, USA
Coordinates	Lat. (^o)	39.070856	Long. (^o)	-96.582821	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045430	Metagenome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208475_10311501	F045430	N/A	AYADDTIQHAAKEFASAIQNPKELQDLIGDDGLIVIRNFVTGGWGTRGRDIRYSLQKRDVPLDGSFPVKGEIPVLLSSLFAESAKKGLDAEFLTVQAKSNLCFFSKRSKKCSQFPTTNDAINSIAEAISDIRLGTVSIVHLSPDEFLHTEGEAIDGLPVGGFAVFSMRQGRYRLV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.