NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208475_1034421

Scaffold Ga0208475_1034421


Overview

Basic Information
Taxon OID3300027018 Open in IMG/M
Scaffold IDGa0208475_1034421 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameManhattan, Kansas, USA
CoordinatesLat. (o)39.070856Long. (o)-96.582821Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013652Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0208475_10344212F013652N/ASPELTRLFLKNAQIERDCPKGDLCGLEFDPILGGQDFDDHFNFKLHIAEATPPQTGRFEVRFKLFNDEKPEHEQVLIFQLVQLKNGWRIDDIIYTKENASLKAVITAILDEAAHLKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.