NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209879_1009062

Scaffold Ga0209879_1009062


Overview

Basic Information
Taxon OID3300027056 Open in IMG/M
Scaffold IDGa0209879_1009062 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1595
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Columbia River, Washington
CoordinatesLat. (o)46.372Long. (o)-119.272Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002554Metagenome / Metatranscriptome549Y
F009924Metagenome / Metatranscriptome311Y

Sequences

Protein IDFamilyRBSSequence
Ga0209879_10090622F002554N/AMIHPTVRFLNELTGHRGAYPLLSPQFSRHFPPAVAKVYIVSFRSHDDRRPSKFIVLADNMKSAIKMAWEHGGADFQSRFDKSTAQAAEMKEGALRVL
Ga0209879_10090623F009924AGGAGMTVLEALATLESATLECKQRDIDTPEVREALTLLEPHIQPEWLIPQFRYHVQRYGQQHWWELEAQQQVLCAIFPRIRESVKELIGKQMAALARNFAATHNMKVKDEINLLAREYGKLGEPWVFVAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.